PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do011143.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 340aa    MW: 36020.7 Da    PI: 8.4562
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do011143.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1177.5e-37188249263
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                 kekal+cprC+stntkfCyynnysl+q ryfCk CrryWt+GG+l+n+PvGgg+rknk+sss
  Do011143.1 188 KEKALNCPRCNSTNTKFCYYNNYSLQQVRYFCKMCRRYWTEGGSLQNIPVGGGSRKNKRSSS 249
                 7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF024586.3E-62102IPR003480Transferase
Gene3DG3DSA:3.30.559.106.7E-132100IPR023213Chloramphenicol acetyltransferase-like domain
ProDomPD0074784.0E-29184246IPR003851Zinc finger, Dof-type
PfamPF027011.5E-30190246IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.167192246IPR003851Zinc finger, Dof-type
PROSITE patternPS013610194230IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0016747Molecular Functiontransferase activity, transferring acyl groups other than amino-acyl groups
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MPNYIGNVTT FAIREASVDE VQRMALPDVA AMVREAITAP AYDEHFQELV DWVEEHKAGR  60
YVETASLGLG SPTVSVTAFT SFPIDTDFGF GYAAMAMPTT TSTLKSKGSS QFQFLFGCTN  120
CGIQYYEEFE HYISFSILST ANTGQGGSNP NLPVLAPSSV PGGSALHGGV PQAVAGAGST  180
ERRARPQKEK ALNCPRCNST NTKFCYYNNY SLQQVRYFCK MCRRYWTEGG SLQNIPVGGG  240
SRKNKRSSSS SASASTSASV TSSSMASTAG RRPRTLYLAL IPLVVLLARG LLALPLIRIW  300
EGGRDGVGFV PVVGGASPAA RVEAPPAYGG GDGATPPCGC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824131e-108KC582413.1 Sorghum bicolor dof20 protein (dof20) gene, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.18e-37Dof family protein